PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000695714
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 604aa    MW: 67482.8 Da    PI: 4.4151
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000695714genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.82.2e-5391361128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                    l+pGfrFhPtdeelv++yLk+kv+gk++++ + i+ vdiyk+ePwdLp k k+k+++ ewyfFs  dkky +++r+nrat++gyWk+tgkd+++++
  MDP0000695714   9 LAPGFRFHPTDEELVWYYLKRKVSGKNFRF-DPISVVDIYKTEPWDLPgKsKLKTRDLEWYFFSFLDKKYGNSSRTNRATEKGYWKTTGKDRPIKH 103
                    579**************************9.99***************5347777888************************************** PP

            NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++++vg+kktLvf++grap+g +t+Wvmheyrl
  MDP0000695714 104 -NSRDVGMKKTLVFHSGRAPTGARTNWVMHEYRL 136
                    .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.55E-616160IPR003441NAC domain
PROSITE profilePS5100557.4969160IPR003441NAC domain
PfamPF023657.6E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MARGKENSLA PGFRFHPTDE ELVWYYLKRK VSGKNFRFDP ISVVDIYKTE PWDLPGKSKL  60
KTRDLEWYFF SFLDKKYGNS SRTNRATEKG YWKTTGKDRP IKHNSRDVGM KKTLVFHSGR  120
APTGARTNWV MHEYRLSNEE LEKAGIQQKD PYVLCRIFQK SGTGPKNGEK YGAPVMEEEW  180
DDDDVTCVPG EEAAANVVAV SEEPDNEAND FNNGAYVEAF DLDQNLDTGI PSESAPPPLN  240
FYHGETSNYI EHYGDFVEDD TKAVIGTGET SEYCEHQMFF GYPEHYETVG NPVKNEYITS  300
QNPEDLKFVD LTEHYEADAK PVKDECFLEP SDGANPSVVN YSLNEPYLDA TENNKPFGDG  360
LFLETNDLSN PVESTAGFDM LDEYLTYFDA NDDISQYIDF DSCGNVPDQA PSNQKLLNGE  420
TEPQPMGGDH LVQPEPQPMG GEHLVQPEDT DDASLSKKMP ESKFESDGNY PFIKKASHMM  480
LGSIPAPPAF ASEFPAKEAM LRLNSGASSS SSVHVTAGMI RIRDITSSDN RMDWSFGKDG  540
VVNLVFSVQL SQNDGNSGNL VPVGGSLSGK TGCVVMRGWF LFMFLWVLFL SMSFKIGSYI  600
CTR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-45616012168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.38570.0bud| cell culture| fruit| leaf| root| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008339778.10.0PREDICTED: NAC domain-containing protein 78-like isoform X1
TrEMBLD9ZJA80.0D9ZJA8_MALDO; NAC domain class transcription factor
STRINGVIT_13s0019g05240.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53473247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-129NAC domain containing protein 2